Protein Info for PP_4829 in Pseudomonas putida KT2440

Annotation: putative precorrin-3B synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 TIGR02435: precorrin-3B synthase" amino acids 17 to 404 (388 residues), 382.4 bits, see alignment E=1.2e-118 PF03460: NIR_SIR_ferr" amino acids 32 to 92 (61 residues), 44.4 bits, see alignment E=1.2e-15 amino acids 266 to 329 (64 residues), 55.6 bits, see alignment E=3.5e-19 PF01077: NIR_SIR" amino acids 101 to 228 (128 residues), 53.8 bits, see alignment E=1.6e-18

Best Hits

KEGG orthology group: K02229, precorrin-3B synthase [EC: 1.14.13.83] (inferred from 100% identity to ppu:PP_4829)

Predicted SEED Role

"Cobalamin biosynthesis protein CobG" in subsystem Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DJ6 at UniProt or InterPro

Protein Sequence (443 amino acids)

>PP_4829 putative precorrin-3B synthase (Pseudomonas putida KT2440)
MPDTPLTQAEAPTVIPRPSACPGLWRIVSARDGGICRIKLPGGLLLAEQAEAVAAAAERF
AGGVIEATNRGNLQIRGIGSEHRALVEALLAAGLGPRDAAGDDVRNVMLSPLAGHDPLML
LDARPLAGQILDLLEGTPRFHQLSAKFAVQLDAGERLAMLEHPHDLWLSPLHLDQQTWLA
FGLAGCPAEGQALGAVPLTQGLMLVRAVLERFLDLASPTQTRMRQLLDVYPTADFVAGLG
LDIRRDAAVLTWRREQHRASWLGRLPQAQGVALGVAPPQGRLTPAMLRGAARIARELGDA
SMRLSPWQSLVLSNLQAQHIDQALAELSALGLLCHDREPLARISACTGASGCAKALAETK
ADAVVLAALLGPGVPASVHLSGCPRSCAVAHVAPATLLARSPGRYDLYLRDARQPGFGAL
RATDLTLNEAGAMLDLPTEHLDD