Protein Info for PP_4823 in Pseudomonas putida KT2440

Annotation: Phosphoribosylamine--glycine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02844: GARS_N
  • amino acids 1 to 101 (101 residues), 129.2 bits, E=1.9e-41
• TIGR00877: phosphoribosylamine--glycine ligase
  • amino acids 1 to 422 (422 residues), 600.4 bits, E=8.6e-185
• PF01071: GARS_A
  • amino acids 102 to 295 (194 residues), 279.6 bits, E=3e-87
• PF02786: CPSase_L_D2
  • amino acids 108 to 249 (142 residues), 24.7 bits, E=3.1e-09
• PF02843: GARS_C
  • amino acids 331 to 420 (90 residues), 113 bits, E=1.3e-36

Best Hits

Swiss-Prot: 100% identical to PUR2_PSEPK: Phosphoribosylamine--glycine ligase (purD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01945, phosphoribosylamine--glycine ligase [EC: 6.3.4.13] (inferred from 99% identity to ppg:PputGB1_4876)

MetaCyc: 76% identical to phosphoribosylamine--glycine ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylamine--glycine ligase. [EC: 6.3.4.13]

Predicted SEED Role

"Phosphoribosylamine--glycine ligase (EC 6.3.4.13)" in subsystem De Novo Purine Biosynthesis (EC 6.3.4.13)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.13

Sequence Analysis Tools

See Q88DK2 at UniProt or InterPro

Protein Sequence (431 amino acids)

>PP_4823 Phosphoribosylamine--glycine ligase (Pseudomonas putida KT2440)
MKVLIIGSGGREHALAWKVAQDPRVEKVFVAPGNAGTAIEAKCENVAIDVCALEQLADFA
EKNVDLTIVGPEAPLVIGVVDLFRSRGLDCFGPTKGAAQLEGSKAFTKDFLARHEIPTAD
YQNFTEIEPALAYLQEKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVRDMLAGNAFGEAG
SRVVIEEFLDGEEASFIVMVDGHNVLPMATSQDHKRVGDQDTGPNTGGMGAYSPAPVVTA
DVHQRVMDQVIWPTVRGMAEEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVML
RLESSLVLLVEAAFAKALDKVEAQWDPRPSLGVVLAAGGYPGDYAKGDVINGLDAAAKIE
GKVFHAGTALKDGKVTTNGGRVLCATAMGSTVADAQQQAYRLAKEVSWNGSFYRSDIGYR
AIARERGEHQQ