Protein Info for PP_4810 in Pseudomonas putida KT2440

Annotation: Probable nicotinate-nucleotide adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00125: cytidyltransferase-like domain
  • amino acids 21 to 82 (62 residues), 32.7 bits, E=6.7e-12
• PF01467: CTP_transf_like
  • amino acids 23 to 200 (178 residues), 77.7 bits, E=5.1e-26
• TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase
  • amino acids 23 to 226 (204 residues), 167.4 bits, E=3.9e-53

Best Hits

Swiss-Prot: 100% identical to NADD_PSEPK: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 100% identity to ppu:PP_4810)

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• NAD de novo biosynthesis I (5/6 steps found)
• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (3/4 steps found)
• NAD de novo biosynthesis III (4/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (4/6 steps found)
• NAD salvage pathway I (PNC VI cycle) (4/7 steps found)
• NAD salvage pathway V (PNC V cycle) (2/5 steps found)
• NAD de novo biosynthesis II (from tryptophan) (3/9 steps found)
• NAD salvage (plants) (4/11 steps found)
• superpathway of NAD biosynthesis in eukaryotes (5/14 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Sequence Analysis Tools

See Q88DL5 at UniProt or InterPro

Protein Sequence (230 amino acids)

>PP_4810 Probable nicotinate-nucleotide adenylyltransferase (Pseudomonas putida KT2440)
MASCAARGPAELSKAQAVRRIGILGGTFDPVHIGHLRSALEVAEFMGLDELRLLPNARPP
HRDTPQVAAQDRLAMVREAVQGVACLSVDARELERDKPSYTIDTLESIRAELSGHDQLFL
VLGWDAFCGLPAWHRWEELLQHCHILVLQRPDADVEPPDELRNLLAARSESDPTAMSGPA
GNISFVWQTPLAVSATQIRQLLASGKSVRFLVPDAVLAYIEAHELYRAPN