Protein Info for PP_4810 in Pseudomonas putida KT2440

Annotation: Probable nicotinate-nucleotide adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 TIGR00125: cytidyltransferase-like domain" amino acids 21 to 82 (62 residues), 32.7 bits, see alignment E=6.7e-12 TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase" amino acids 23 to 226 (204 residues), 167.4 bits, see alignment E=3.9e-53 PF01467: CTP_transf_like" amino acids 23 to 200 (178 residues), 77.7 bits, see alignment E=5.1e-26

Best Hits

Swiss-Prot: 100% identical to NADD_PSEPK: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 100% identity to ppu:PP_4810)

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DL5 at UniProt or InterPro

Protein Sequence (230 amino acids)

>PP_4810 Probable nicotinate-nucleotide adenylyltransferase (Pseudomonas putida KT2440)
MASCAARGPAELSKAQAVRRIGILGGTFDPVHIGHLRSALEVAEFMGLDELRLLPNARPP
HRDTPQVAAQDRLAMVREAVQGVACLSVDARELERDKPSYTIDTLESIRAELSGHDQLFL
VLGWDAFCGLPAWHRWEELLQHCHILVLQRPDADVEPPDELRNLLAARSESDPTAMSGPA
GNISFVWQTPLAVSATQIRQLLASGKSVRFLVPDAVLAYIEAHELYRAPN