Protein Info for PP_4809 in Pseudomonas putida KT2440

Annotation: Ribosomal silencing factor RsfS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 TIGR00090: ribosome silencing factor" amino acids 15 to 109 (95 residues), 125.1 bits, see alignment E=5.1e-41 PF02410: RsfS" amino acids 17 to 109 (93 residues), 120.3 bits, see alignment E=1.8e-39

Best Hits

Swiss-Prot: 58% identical to IOJAP_PSEAB: Ribosomal silencing factor RsfS (rsfS) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K09710, ribosome-associated protein (inferred from 100% identity to ppu:PP_4809)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DL6 at UniProt or InterPro

Protein Sequence (139 amino acids)

>PP_4809 Ribosomal silencing factor RsfS (Pseudomonas putida KT2440)
MTKQKIYGEELVAVTKAALEDVKAQDIQVIDVREKHSLTDYMIIATGTSNRQINAMAEKV
REAVKAKGAQPLGEEGKGDSDWVLLDLNDVIVHMMTAAARQFYDLERLWQGAEQSRAADG
KHHSPDHAHEYSDKLKDRE