Protein Info for PP_4798 in Pseudomonas putida KT2440

Annotation: putative Membrane-bound lytic murein transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details TIGR02283: lytic murein transglycosylase" amino acids 66 to 362 (297 residues), 401.2 bits, see alignment E=1.4e-124 PF13406: SLT_2" amino acids 66 to 359 (294 residues), 394 bits, see alignment E=4e-122 PF01471: PG_binding_1" amino acids 380 to 435 (56 residues), 44 bits, see alignment 2.1e-15

Best Hits

KEGG orthology group: K08305, membrane-bound lytic murein transglycosylase B [EC: 3.2.1.-] (inferred from 100% identity to ppf:Pput_4673)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DM7 at UniProt or InterPro

Protein Sequence (438 amino acids)

>PP_4798 putative Membrane-bound lytic murein transglycosylase (Pseudomonas putida KT2440)
MLFRLIPRWETRQLIAASSFILLVACAEKPTAADALPLAPAQPNPVVTVPGATPDVSTDI
QPLQTFAQWQAGFREQALQAGISPSTFDRAFLGVTPDLDVIKADRSQPEFTRPVWEYLEG
ALSPLRVRNGKKLLEQNAELLTRLEQRYGVDRQVLVAVWGMESNFGQFQGSKSVIRSLAT
LAYEGRRPQFAQDQLIAALQIIQHGDIQPEAMRGSWAGAMGQTQFIPTTYNTHAVDFDGD
GRRDIWNSTPDALASTAHYLQSSGWKRGQPWGFEVQVPAGFDFWQADGALRKPVSEWLAM
GVKLPAGTQLPAGSNQLSAALLLPAGARGPAFLVLDNFRAILKYNNSSSYALAVSLLGDR
FSGWGFIAGSWPKEDLPLSRTERMELQNLLNSRGHDAGNADGIIGANTRKAIRNAQQGLG
WPADGYPTHKLLESLRQQ