Protein Info for PP_4781 in Pseudomonas putida KT2440

Annotation: Sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 662 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 183 to 205 (23 residues), see Phobius details amino acids 212 to 238 (27 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 306 to 327 (22 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details amino acids 363 to 384 (22 residues), see Phobius details PF07696: 7TMR-DISMED2" amino acids 31 to 171 (141 residues), 141.5 bits, see alignment E=3.4e-45 PF07695: 7TMR-DISM_7TM" amino acids 184 to 386 (203 residues), 189 bits, see alignment E=2e-59 PF00512: HisKA" amino acids 419 to 483 (65 residues), 49.2 bits, see alignment E=9.1e-17 PF02518: HATPase_c" amino acids 530 to 644 (115 residues), 64.7 bits, see alignment E=2.1e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4781)

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DP3 at UniProt or InterPro

Protein Sequence (662 amino acids)

>PP_4781 Sensor histidine kinase (Pseudomonas putida KT2440)
MRYLLIVLLGLLPVLAGAVDFDDATRHLPLGKAMQVYEDPDGNASIAQVSAPGFAKHFQP
HHEDVLNAGYSTSVFWLKVELRPTAAPNAAPRSWLLELAYPPLDHLELYLPDSSGLYRLA
QRTGDALPYDSRQIRQNNYLFELQLPPGKVTTAYLRLHSQGSVQAPLALWSPEAYLEEQP
TRLYVLGMIYGVLLVMLVYNLFIYLSVRDVSYLYYILYIASFGLYQVSVNGAGVAYFWPD
SPWWANASTPLFIGAAGLFGCQFARHFLQLGSLNRGFDRLLQLLMLGGALVMVLAVSMPY
GIALRMATLLALLFTISVFSAGLYAWWRGLRVARWFIIAWTAFLLGGLVNTLMVLGYLPN
VFITMYASQLGSALEVALLSLALADRINSLREQQAQTLRDTGRTLEQLNLQLARSNRLKD
EFLASVTHELRTPMNGVIGSLELMHTLPMGAEMAQYHHTAVGSAQGMMDMVDAILTLSEL
QAGRLRAQPAPFSLRALLQGLRAGYAGQALGKGLYLSLDIPADLPDGLLGDGQKLAHCLG
CLVDNGLKFTHQGGVMIQVRGRRVGPDDLALTFTVSDSGIGFDDLEQSTLYQRFFQVDGS
MTRRYGGLGIGLSICRQMGELLGARLAHESTRGLGSRFELSLNMAISQAQMSPHMLQARR
SL