Protein Info for PP_4758 in Pseudomonas putida KT2440

Annotation: Major facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 32 to 50 (19 residues), see Phobius details amino acids 64 to 82 (19 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 259 to 281 (23 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 325 to 341 (17 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details amino acids 379 to 402 (24 residues), see Phobius details amino acids 414 to 433 (20 residues), see Phobius details PF07690: MFS_1" amino acids 37 to 399 (363 residues), 160.8 bits, see alignment E=2.3e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4758)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DR5 at UniProt or InterPro

Protein Sequence (455 amino acids)

>PP_4758 Major facilitator family transporter (Pseudomonas putida KT2440)
MGDPQVNDTLAPSARHEGDALASAVAKVKRHVLPLFVIMFIVNYLDRVNIGFVRPHLESD
LGISAAAYGFGAGLFFIGYALFEVPSNMLLQKVGARLWLTRIMFTWGLVATAMAFVQNET
QFYVLRFLLGVAEAGFFPGVIYYFTRWLPAAERGKAIAIFLSGSALASLISGPLAGALMQ
IQGLGLHGWQWMLFIEGMASVALCFFVFFWLDSKPQDAKWLSKAEQDALVATIDREQQAR
EAIGAVRPSAWNLLKDRQIVLFCLIYFCIQLTIYAATFWLPSIIKRMGDLSDMQVGFFNS
IPWLISILAMYAFAAGSARWKFQQAWVAGALLVAATGMFMSTTGGPVFAFVAVCFAAIGF
KSASSLFWPIPQGYLDARIAAAVIALINSVGNLGGFVAPTTFGLLEQQTGSIQGGLYGLA
VTSVLAAIAIFFVRTRPKGAPSDDLKAPSALGQTH