Protein Info for PP_4757 in Pseudomonas putida KT2440

Annotation: D-glucarate dehydratase / L-idarate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 TIGR03247: glucarate dehydratase" amino acids 9 to 448 (440 residues), 887.7 bits, see alignment E=6.3e-272 PF02746: MR_MLE_N" amino acids 44 to 140 (97 residues), 24.6 bits, see alignment E=2.5e-09 PF13378: MR_MLE_C" amino acids 191 to 407 (217 residues), 160.2 bits, see alignment E=6.4e-51

Best Hits

Swiss-Prot: 79% identical to GUDD_PSEPU: Glucarate dehydratase (gudD) from Pseudomonas putida

KEGG orthology group: K01706, glucarate dehydratase [EC: 4.2.1.40] (inferred from 100% identity to ppu:PP_4757)

MetaCyc: 79% identical to D-glucarate dehydratase subunit (Pseudomonas putida)
Glucarate dehydratase. [EC: 4.2.1.40]

Predicted SEED Role

"Glucarate dehydratase (EC 4.2.1.40)" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism (EC 4.2.1.40)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DR6 at UniProt or InterPro

Protein Sequence (448 amino acids)

>PP_4757 D-glucarate dehydratase / L-idarate epimerase (Pseudomonas putida KT2440)
MNMQTLHTSTPVVTDLRVVPVAGHDSMLLNLSGAHGPFFTRNVVVLRDSAGNTGLGEVPG
GEKIRQTLEDARSLVVGQPIGHYQRVLNAMRQTFANRDSAGRGLQTFDLRITVHAVTAIE
SALLDLLGQHLNVPMAALLGEGQQRDAVKMLGYLFYIGDRQQTDLAYRNEADSDDDWFRL
RHEKALTPEAVVRLAEAAKARYGFSDFKLKGGVLRGEEEMEAVTALAERFPEARITLDPN
GAWSLKEAIALCRDKHNVLAYAEDPCGAENGYSGREVMAEFRRATGLPTATNMIATDWRQ
MGHAIQLQSVDIPLADPHFWTLQGSVRVAQMCNDWGLTWGSHSNNHFDISLAMFTQVAAA
APGEITAIDTHWIWQDGQRLTREPLRIVDGHVRVPARPGLGVELDEDQLAKAHECYRNMG
LGARDDSVAMQFLIPGWSFDNKRPCLVR