Protein Info for PP_4755 in Pseudomonas putida KT2440

Annotation: Outer membrane ferrichrome-iron receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 797 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF07660: STN" amino acids 69 to 119 (51 residues), 28.8 bits, see alignment 1.3e-10 PF07715: Plug" amino acids 172 to 268 (97 residues), 72.6 bits, see alignment E=5.4e-24 TIGR01783: TonB-dependent siderophore receptor" amino acids 173 to 795 (623 residues), 298.5 bits, see alignment E=6.1e-93 PF00593: TonB_dep_Rec_b-barrel" amino acids 342 to 768 (427 residues), 177 bits, see alignment E=1.9e-55

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to ppu:PP_4755)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DR8 at UniProt or InterPro

Protein Sequence (797 amino acids)

>PP_4755 Outer membrane ferrichrome-iron receptor (Pseudomonas putida KT2440)
MSFTPVPQRHPLSRALHAALLGLAVSTYALPSLAQPLNADHNNPLKQWSIPAGPLAPALD
RFAREAGISLSFDAQNVANRNTNGVQGALDTRSALSSLLRGTELQIEPQGPNAYLVIPQP
KPAGPLELGVTEDYRLAPVIINAKVKASADDDANSVVAKELWVGGKVATSILNTPASVSV
VTNKEMQQRSVSTTEEALQYTPGVVSDYYGSDDRNDYFLIRGFQATTYRDGLTLSSMRGV
REDPYAYERIEILRGANSTLFGPADPGGSVNFVTKQPRFEKFGQGYVTYGSYDHAETGID
VGDALNDEQTLAGRFTAKMQNSDREYDHSQDDNRFVMGGLTWAPTDFTSATVVLDYLKTN
SSPNSGGYPLDKGYDRSDFYGEPGYNFHDVERTSLSGNITHDFDNGFTLRSNLRYSELTD
DFGYVYLSDNASRVGTTIPRYVFGTDSDADQLNGNLMLQYDAQFEHIDSSTLVGVEYLDS
TTKQSSVYSLAPSIDIANPVFTGVPGGITPYTRKKNDATTKAVFLQQNLSFFDRVIATAG
VRNDSMDLSSKEYIGGEQTEKDNFSETSYRAALTYIVNDEVSTYVSMVESVSPPQVGVTP
QTGKQYEVGIKYSPMGMDALFSAAVYDLTQENVTIAVVLPSGIIEQQTVGESRVRGLDLE
AKAQVTQDISVIGAYSYMESEVLRGSLYDGSSLKGNEFTTAPKHTASLWSYYDIPGTDVS
VGLGARYVGAYYMDAANTKKSDGTTLFDAALNYKIAKGTDLALNVSNLFDEQHVVGSGTA
NYYNPGREVTAKVSYSW