Protein Info for PP_4750 in Pseudomonas putida KT2440

Annotation: Amino acid ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 43 to 69 (27 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 103 to 118 (16 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 6 to 102 (97 residues), 77.1 bits, see alignment E=6.4e-26 PF00528: BPD_transp_1" amino acids 27 to 207 (181 residues), 69.8 bits, see alignment E=1.3e-23

Best Hits

Swiss-Prot: 32% identical to YCKA_BACSU: Probable amino-acid ABC transporter permease protein YckA (yckA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4750)

Predicted SEED Role

"amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DS3 at UniProt or InterPro

Protein Sequence (213 amino acids)

>PP_4750 Amino acid ABC transporter, permease protein (Pseudomonas putida KT2440)
MKDILMMLLNGIPWTIAVTVLAFCVGVVLGFPICALRMSRVKVLSILAAMLVLTLRSIPP
IVWLFFIFFGIGGGYISLSPFTAAVVGLGLITAAHMSEVYRGAFAAIPAGQFEAAYVLNL
SAPQRFFDVVLPQLVRIAIPTSATYAIGLLKDSAVASTIGVGEISFQAYQVSQQTFQGLS
VYTAAAVVYLVLSVPVALFSRWLSATLKQRIAR