Protein Info for PP_4741 in Pseudomonas putida KT2440

Annotation: Type I restriction enzyme EcoEI M protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 PF12161: HsdM_N" amino acids 4 to 129 (126 residues), 58.5 bits, see alignment E=2.3e-19 PF02384: N6_Mtase" amino acids 140 to 454 (315 residues), 268.3 bits, see alignment E=1.9e-83 PF01170: UPF0020" amino acids 174 to 279 (106 residues), 24.1 bits, see alignment E=5.5e-09 PF07669: Eco57I" amino acids 264 to 356 (93 residues), 31.3 bits, see alignment E=4.2e-11

Best Hits

Swiss-Prot: 68% identical to T1ME_ECOLX: Type I restriction enzyme EcoEI M protein (hsdM) from Escherichia coli

KEGG orthology group: K03427, type I restriction enzyme M protein [EC: 2.1.1.72] (inferred from 100% identity to ppu:PP_4741)

Predicted SEED Role

"Type I restriction-modification system, DNA-methyltransferase subunit M (EC 2.1.1.72)" in subsystem Restriction-Modification System (EC 2.1.1.72)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DS8 at UniProt or InterPro

Protein Sequence (489 amino acids)

>PP_4741 Type I restriction enzyme EcoEI M protein (Pseudomonas putida KT2440)
MSISSTIKSIQDIMRKDVGVDGDAQRIGQLVWLLFLKIFDDRELEWELMDDNYKSPIPDS
CRWRTWAADPEGMTGDALKDFIDNNLFPQLQNLHEYSNTPSAFVVRSVFEDAYNYMKSGQ
LLRQVINKIQEGVDFNRAQERHEFGNLYEQLLRDLQNAGNAGEFYTPRPVTEFMVRMVDP
KLAEKVMDPACGTGGFLTCAIEHKRRRYVKTAEDERTLQASIFGVEKKPLPHLLATTNMI
LHGIEVPSQIRHDNTLSKPLISWGPSERVHCIVANPPFGGMEEDGIETNFPAAFRTRETA
DLFLVLIMQLLKDGGRAAVVLPDGFLFGEGIKSRIKEKLLTECNLHTIVRLPNGVFNPYT
GIKTNLLFFTKGTPTKQVWFYEHQYPAGVKNYSKTRPMRIEEFAVEEAWWGSEADGFAAR
AENAFAWQVSVEELQARNWNLDCKNPHTGEQVSHDPDELLRNYASVQDEISDLRDQLKAV
LAEALRRKV