Protein Info for PP_4736 in Pseudomonas putida KT2440

Annotation: L-lactate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 PF01070: FMN_dh" amino acids 13 to 375 (363 residues), 427.5 bits, see alignment E=6.1e-132 PF01645: Glu_synthase" amino acids 295 to 336 (42 residues), 21.9 bits, see alignment 1.4e-08

Best Hits

Swiss-Prot: 100% identical to LLDD_PSEP1: L-lactate dehydrogenase (lldD) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K00101, L-lactate dehydrogenase (cytochrome) [EC: 1.1.2.3] (inferred from 100% identity to ppf:Pput_4602)

MetaCyc: 85% identical to L-lactate dehydrogenase (Escherichia coli K-12 substr. MG1655)
1.1.5.M6 [EC: 1.1.5.M6]; RXN0-7227 [EC: 1.1.5.M6]

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.2.3)" in subsystem L-rhamnose utilization or Lactate utilization or Respiratory dehydrogenases 1 (EC 1.1.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.2.3 or 1.1.5.M6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DT3 at UniProt or InterPro

Protein Sequence (381 amino acids)

>PP_4736 L-lactate dehydrogenase (Pseudomonas putida KT2440)
MIISASTDYRAAAQRKLPPFLFHYADGGAYAEHTLRHNVSDLAGIALRQRVLNNMSELSL
ETKLFDETLSMPVALAPVGLTGMYARRGEVQAARAAAAHGIPFTMSTVSVCPIEEVAPAI
NRPMWFQLYVLKDRGFMRNALERAKAAGVKTLVFTVDMPVPGARYRDAHSGMSGKNGPLR
RVLQAMTHPEWAWDVGVMGRPHDLGNISKYRGNPTGLADYIGWLGNNFDPSISWKDLEWI
REFWDGPMIIKGILDADDARDAVKFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD
LKILADSGIRSGLDVVRMIALGADTVLIGRAFLYALAVHGQAGVKNLLELFEKEMRVAMV
LTGAKSISEITRDSLVRELGA