Protein Info for PP_4724 in Pseudomonas putida KT2440

Annotation: Carbamoyl-phosphate synthase small chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 TIGR01368: carbamoyl-phosphate synthase, small subunit" amino acids 5 to 375 (371 residues), 474.5 bits, see alignment E=9.8e-147 PF00988: CPSase_sm_chain" amino acids 7 to 132 (126 residues), 178 bits, see alignment E=9.9e-57 PF00117: GATase" amino acids 196 to 372 (177 residues), 182.1 bits, see alignment E=1.4e-57 PF07722: Peptidase_C26" amino acids 250 to 288 (39 residues), 24.8 bits, see alignment 2.7e-09

Best Hits

Swiss-Prot: 100% identical to CARA_PSEPK: Carbamoyl-phosphate synthase small chain (carA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01956, carbamoyl-phosphate synthase small subunit [EC: 6.3.5.5] (inferred from 100% identity to ppf:Pput_4590)

Predicted SEED Role

"Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)" in subsystem De Novo Pyrimidine Synthesis or Macromolecular synthesis operon (EC 6.3.5.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.5

Use Curated BLAST to search for 6.3.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DU5 at UniProt or InterPro

Protein Sequence (378 amino acids)

>PP_4724 Carbamoyl-phosphate synthase small chain (Pseudomonas putida KT2440)
MTKPAILALADGSIFRGEAIGADGQTVGEVVFNTAMTGYQEILTDPSYAQQIVTLTYPHI
GNTGTTPEDAESSRVWSAGLVIRDLPLLASNWRNTQSLPEYLKANNVVAIAGIDTRRLTR
ILREKGAQNGCILAGDNISEEAAIAAARGFPGLKGMDLAKVVSTKERYEWRSSVWELKTD
SHPTIDAADLPYHVVAFDYGVKLNILRMLVARGCRVTVVPAQTPASEVLALNPDGVFLSN
GPGDPEPCDYAIQAIKEILETEIPVFGICLGHQLLALASGAKTVKMGHGHHGANHPVQDL
DTGVVMITSQNHGFAVDEATLPGNVRAIHKSLFDGTLQGIERTDKSAFSFQGHPEASPGP
TDVAPLFDRFTDAMAKRR