Protein Info for PP_4718 in Pseudomonas putida KT2440

Annotation: integral membrane ATP-dependent zinc metallopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 101 to 123 (23 residues), see Phobius details PF06480: FtsH_ext" amino acids 8 to 96 (89 residues), 62.9 bits, see alignment E=8.7e-21 TIGR01241: ATP-dependent metallopeptidase HflB" amino acids 102 to 599 (498 residues), 784.1 bits, see alignment E=2.8e-240 PF06068: TIP49" amino acids 152 to 226 (75 residues), 26.4 bits, see alignment E=1.1e-09 PF07728: AAA_5" amino acids 192 to 314 (123 residues), 25.6 bits, see alignment E=3.3e-09 PF00004: AAA" amino acids 193 to 325 (133 residues), 162.9 bits, see alignment E=1.6e-51 PF17862: AAA_lid_3" amino acids 349 to 391 (43 residues), 45.8 bits, see alignment 1e-15 PF01434: Peptidase_M41" amino acids 406 to 598 (193 residues), 239.5 bits, see alignment E=8.5e-75

Best Hits

Swiss-Prot: 66% identical to FTSH_PHOPR: ATP-dependent zinc metalloprotease FtsH (ftsH) from Photobacterium profundum (strain SS9)

KEGG orthology group: K03798, cell division protease FtsH [EC: 3.4.24.-] (inferred from 100% identity to ppu:PP_4718)

MetaCyc: 68% identical to ATP-dependent zinc metalloprotease FtsH (Escherichia coli K-12 substr. MG1655)
3.4.24.-

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DV1 at UniProt or InterPro

Protein Sequence (637 amino acids)

>PP_4718 integral membrane ATP-dependent zinc metallopeptidase (Pseudomonas putida KT2440)
MNDMAKNLILWLIIAAVLVTVMNNFSSPNEPQTLNYSDFIQQVKDGKVERVTVDGYIITG
KRTDGDNFKTVRPAITDNGLIGDLVDNHVVVEGKQPEQQSIWTQLLVASFPILVIIAVFM
FFMRQMQGGAGGKGGPMSFGKSKARLLSEDQVKTTLADVAGCDEAKEEVGELVEFLRDPG
KFQRLGGRIPRGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRD
MFEQAKKHAPCIIFIDEIDAVGRHRGAGMGGGHDEREQTLNQLLVEMDGFEMNDGIIVIA
ATNRPDVLDPALLRPGRFDRQVVVGLPDIRGREQILKVHMRKVPIGENVNPAVIARGTPG
FSGADLANLVNEASLFAARSNKRLVEMKEFELAKDKIMMGAERKTMVMSEKEKRNTAYHE
AGHAIVGRLVPEHDPVYKVSIIPRGRALGVTMFLPEEDRYSLSKRALISQICSLYGGRIA
EEMTLGFDGVTTGASNDIMRASQLARNMVTKWGLSEKLGPLMYAEEEGEVFLGRSAGSQH
ASVSGETAKLIDSEVRSIIDQCYATAKQLLIDNRDKLEAMTEALMKYETIDADQIDDIMA
GRTPREPRDWDDDKHSGTPAAQDERPESPIGGPAAEH