Protein Info for PP_4716 in Pseudomonas putida KT2440

Annotation: Phosphoglucosamine mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 3 to 134 (132 residues), 155.1 bits, E=1.8e-49
• TIGR01455: phosphoglucosamine mutase
  • amino acids 6 to 441 (436 residues), 638.8 bits, E=2.1e-196
• PF02879: PGM_PMM_II
  • amino acids 156 to 253 (98 residues), 67.9 bits, E=2e-22
• PF02880: PGM_PMM_III
  • amino acids 257 to 364 (108 residues), 116 bits, E=2e-37
• PF00408: PGM_PMM_IV
  • amino acids 372 to 441 (70 residues), 58.6 bits, E=1.1e-19

Best Hits

Swiss-Prot: 100% identical to GLMM_PSEPK: Phosphoglucosamine mutase (glmM) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 99% identity to ppf:Pput_4582)

MetaCyc: 62% identical to phosphoglucosamine mutase (Escherichia coli K-12 substr. MG1655)
Phosphoglucosamine mutase. [EC: 5.4.2.10]

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• colanic acid building blocks biosynthesis (9/11 steps found)
• glycogen degradation II (5/6 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• glucose and glucose-1-phosphate degradation (4/5 steps found)
• glycogen degradation I (6/8 steps found)
• sucrose biosynthesis II (6/8 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (3/4 steps found)
• starch degradation V (3/4 steps found)
• peptidoglycan recycling I (10/14 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• sucrose degradation II (sucrose synthase) (3/5 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• starch degradation III (2/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (2/4 steps found)
• chitin biosynthesis (5/9 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• starch biosynthesis (5/10 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (1/5 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (3/8 steps found)
• CMP-legionaminate biosynthesis I (2/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (8/24 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• streptomycin biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.10

Sequence Analysis Tools

See Q88DV3 at UniProt or InterPro

Protein Sequence (446 amino acids)

>PP_4716 Phosphoglucosamine mutase (Pseudomonas putida KT2440)
MSRKYFGTDGIRGRVGEYPITPDFMLKLGWAAGMAFRKQGHCRVLVGKDTRISGYMFESA
LEAGLSAAGADVMLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHDDNGIKFFSGQGTKL
PDEVELMIEELLDQPMTVVESGKLGKVSRINDAAGRYIEFCKSSVPSSTSFEGLKLVVDC
AHGATYKVAPSVFRELGADVTVLHAQPDGLNINEGCGSTHIESLQAAVLVGHADLGIAFD
GDGDRVLMVDHTGAIVDGDELLFIIARDLQEHGKLQGGVVGTLMSNLGLELALKDLDIPF
VRAKVGDRYVMAELLEREWLVGGENSGHVVCCNHTTTGDAIIAALQVLMALKRRGETLAQ
ARQALRKCPQVLINVRFGASKVDPLEHPAVKEASAKVTEALAGRGRVLLRKSGTEPLVRV
MVEGEDESQVRAHAEALAKLVGEVCV