Protein Info for PP_4714 in Pseudomonas putida KT2440

Annotation: ribosome maturation factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 PF02576: RimP_N" amino acids 28 to 100 (73 residues), 109 bits, see alignment E=1.3e-35 PF17384: DUF150_C" amino acids 103 to 168 (66 residues), 68.5 bits, see alignment E=4.7e-23

Best Hits

Swiss-Prot: 100% identical to RIMP_PSEP1: Ribosome maturation factor RimP (rimP) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K09748, ribosome maturation factor RimP (inferred from 98% identity to ppw:PputW619_0719)

Predicted SEED Role

"FIG000325: clustered with transcription termination protein NusA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DV5 at UniProt or InterPro

Protein Sequence (169 amino acids)

>PP_4714 ribosome maturation factor (Pseudomonas putida KT2440)
MGASPIFYLHSMHEGVQVSSKLEQLQALLAPVVEGLGYQCWGIEYVSQGKHSVLRIYIDK
EGGILVDDCEAVSRQASAILDVEDPISSEYTLEVSSPGMDRPLFTLEQFASHAGEQVKIK
LRSPFEGRRNFQGLLRGVEEQDVVVQVDNQEFLLPIDSIDKANIIPSFD