Protein Info for PP_4711 in Pseudomonas putida KT2440

Annotation: Ribosome-binding factor A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 TIGR00082: ribosome-binding factor A" amino acids 1 to 114 (114 residues), 114.4 bits, see alignment E=2.1e-37 PF02033: RBFA" amino acids 7 to 112 (106 residues), 120.5 bits, see alignment E=1.9e-39

Best Hits

Swiss-Prot: 100% identical to RBFA_PSEP1: Ribosome-binding factor A (rbfA) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K02834, ribosome-binding factor A (inferred from 98% identity to ppw:PputW619_0722)

Predicted SEED Role

"Ribosome-binding factor A" in subsystem NusA-TFII Cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DV8 at UniProt or InterPro

Protein Sequence (132 amino acids)

>PP_4711 Ribosome-binding factor A (Pseudomonas putida KT2440)
MAKEYSRTQRIGDQMQRELAELIRREVKDPRVGLVTITAVDVSRDLGHAKVFITVMGEET
PDAVQQSLKALNSAASFLRLHLGRSMQLRSVPQLHFHFDESVSRGVHLSALIERAVAEDR
LHKDADESDTKE