Protein Info for PP_4709 in Pseudomonas putida KT2440

Annotation: 30S ribosomal subunit protein S15

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 TIGR00952: ribosomal protein uS15" amino acids 24 to 107 (84 residues), 125.4 bits, see alignment E=4.4e-41 PF00312: Ribosomal_S15" amino acids 26 to 106 (81 residues), 122 bits, see alignment E=4.6e-40

Best Hits

Swiss-Prot: 100% identical to RS15_PSEPK: 30S ribosomal protein S15 (rpsO) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02956, small subunit ribosomal protein S15 (inferred from 99% identity to pen:PSEEN0798)

MetaCyc: 71% identical to 30S ribosomal subunit protein S15 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S15p (S13e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DV9 at UniProt or InterPro

Protein Sequence (107 amino acids)

>PP_4709 30S ribosomal subunit protein S15 (Pseudomonas putida KT2440)
MSLAYWTPHAGSVIRRSHMALSVEEKAQIVAEYQQAAGDTGSPEVQVALLTANINKLQGH
FKANDKDHHSRRGLIRMVNQRRKLLDYLKGKDTTRYSALIGRLGLRR