Protein Info for PP_4697 in Pseudomonas putida KT2440

Annotation: poly(A) polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 309 to 323 (15 residues), see Phobius details TIGR01942: poly(A) polymerase" amino acids 25 to 460 (436 residues), 692.4 bits, see alignment E=1.1e-212 PF01743: PolyA_pol" amino acids 56 to 188 (133 residues), 144 bits, see alignment E=4.7e-46 PF12627: PolyA_pol_RNAbd" amino acids 215 to 275 (61 residues), 62.8 bits, see alignment E=3.1e-21 PF12626: PolyA_pol_arg_C" amino acids 330 to 447 (118 residues), 148.7 bits, see alignment E=1.1e-47

Best Hits

KEGG orthology group: K00970, poly(A) polymerase [EC: 2.7.7.19] (inferred from 99% identity to ppf:Pput_4562)

Predicted SEED Role

"Poly(A) polymerase (EC 2.7.7.19)" in subsystem Polyadenylation bacterial (EC 2.7.7.19)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DX1 at UniProt or InterPro

Protein Sequence (460 amino acids)

>PP_4697 poly(A) polymerase (Pseudomonas putida KT2440)
MLKKLFQSFRPPVPGPHHRRTTPEVINKSQHSLQRHQFSRHAVNIVERLQSAGYQAYLVG
GCVRDLMLGITPKDFDVATSATPEQVRAEFRNARIIGRRFKLVHVHFGREIIEVATFRAH
HSEDDQGDAHRSSHNASGRILRDNVYGTLEEDAQRRDFTINALYYDPVSERILDYANGVH
DVRNRLLRLIGDPTHRYQEDPVRMLRAVRFAAKLDFGIEKHTYLPIRGLAPMLREIPPAR
LFEECLKLFLSGQGAIAFEMLVDLELFEPLFPASAHALDERPTYTHTLISQALNNTDLRV
KQGKPVTPAFLFAALLWPALPARVLHLQNQGVPPIPAMNGAAHDLIAEQCARIAIPKRFT
LPIREIWDMQERLPRRSGKRADMLLDNPRFRAGYDFLLLRESAGEETDELGQWWTDYQDA
NDSERREMIRELGSRDESAGPRKRKRSGSKRKRSGDEAFE