Protein Info for PP_4695 in Pseudomonas putida KT2440

Annotation: Sensory box histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 991 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 69 to 93 (25 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 185 to 209 (25 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 275 to 298 (24 residues), see Phobius details amino acids 321 to 353 (33 residues), see Phobius details amino acids 374 to 392 (19 residues), see Phobius details amino acids 398 to 422 (25 residues), see Phobius details amino acids 429 to 451 (23 residues), see Phobius details amino acids 471 to 493 (23 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 633 to 748 (116 residues), 30.5 bits, see alignment E=1.7e-11 PF00989: PAS" amino acids 635 to 717 (83 residues), 28.7 bits, see alignment E=1.7e-10 PF00512: HisKA" amino acids 758 to 818 (61 residues), 38.2 bits, see alignment 1.9e-13 PF02518: HATPase_c" amino acids 866 to 976 (111 residues), 90.1 bits, see alignment E=2e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4695)

Predicted SEED Role

"Two-component sensor CbrA: intrcellular carbon:nitrogen balance"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DX3 at UniProt or InterPro

Protein Sequence (991 amino acids)

>PP_4695 Sensory box histidine kinase (Pseudomonas putida KT2440)
MPMSFSLTQMILISAGYLMVLFGVAWISERGLIPRSIIRHPLTYTLSLGVYASAWAFYGS
VGLAYQYGYGFLACYLGVSGAFLLAPVLLYPILKITRTYQLSSLADLLAFRFRSTWAGAL
TTIIMLIGVLPLLALQIQAVADSISILTGEPVKARVAFAFCTLIILFTIFFGSRHIATRE
KHEGLVFAIAFESVIKLLALGGIGLYALYGVFGGPHELEVWLLQNQTALAALHTPLQEGP
WRTLLLVFFASAIVMPHMYHMAFTENLNPRSLVSASWGLPLFLLLMSLAVPLVLWAGLRL
GASTNPEYFTLGLGIAANNQALALLAYIGGLSAASGLIIVTTLALSGMALNHLVLPLYQP
PAEGNIYRWLKWTRRALIVAIITAGFMFYLSQNYHQSLANLGIVAFVATLQFLPGVLSVL
YWPTANRRGFIAGLLAGTLVWMVTMLLPLLGNLQGFYIPLLDMIYVLDDTSWHMAAIASL
AANVLLFTLISLFTNASTEEVSAAEACAVDNVRRPQRRELHAASPQEFATQLAKPLGAKA
AQKEVEQALRDLYLPFDERRPYALRRLRDRIEANLSGLMGPSVAQDMVETFLPYKSGNEN
YVTEDIHFIESRLEDYHSRLTGLAAELDALRRYHRQTLQELPMGVCSLAKDQEILMWNKA
MEELTGIAAKHVVGSRLVTIDEPWRGLLQGFINVPDEHLHKQRLALDGQPRWLNLHKAAI
DEPLAPGNSGLVLLVEDLTETQALEDKLVHSERLASIGRLAAGVAHEIGNPITGIACLAQ
NLREEREDDGEIIELSSQILDQTKRVSRIVQSLMSFAHAGGSHQNSEEPVCLAEVAQDAI
GLLALNRRNFEVQFFNLCDPDHWAEGDPQRLAQVLINLLSNARDASPPGSAVRVRSEVNE
HTVDLIVEDEGSGIPKNIMDRLFEPFFTTKDPGEGTGLGLALVYSIVEEHYGQITIDSPA
DIERQRGTRIRVTLPRHVVATSPEIRDRREN