Protein Info for PP_4681 in Pseudomonas putida KT2440
Annotation: conserved protein of unknown function
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 38% identical to Y1436_HAEIN: Uncharacterized protein HI_1436 (HI_1436) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
KEGG orthology group: None (inferred from 98% identity to ppg:PputGB1_4679)Predicted SEED Role
"Hypothetical protein YqcC (clustered with tRNA pseudouridine synthase C)"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q88DY7 at UniProt or InterPro
Protein Sequence (111 amino acids)
>PP_4681 conserved protein of unknown function (Pseudomonas putida KT2440) MMIEQRVLDIADHLLLIERELQVQGWWDDEPPSDEALASTVPFAVDTLSFEQWLQWIFLP RMKIIIELGHPLPNASSILVMAETVFTDRPEQSRELRRLLAAFDQLIAPSA