Protein Info for PP_4675 in Pseudomonas putida KT2440

Annotation: methionine sulfoxide reductase heme-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 transmembrane" amino acids 5 to 23 (19 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 147 to 164 (18 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details PF01794: Ferric_reduct" amino acids 43 to 155 (113 residues), 63.2 bits, see alignment E=1.3e-21

Best Hits

Swiss-Prot: 100% identical to MSRQ_PSEPK: Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (msrQ) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4675)

Predicted SEED Role

"FIG001196: Membrane protein YedZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DZ3 at UniProt or InterPro

Protein Sequence (197 amino acids)

>PP_4675 methionine sulfoxide reductase heme-binding subunit (Pseudomonas putida KT2440)
MRYPWFRLAIFIVGCLFPVWWLYEAAMNLLGPDPGKIMMDRLGLGALTFLLVTLSMTPLQ
KLTGWSGWIVVRRQLGLWVFAYIVLHILCYLFFILGLDWGQLAVELRKRPYIIVGALGFL
GLLVLAVTSNRYSQRRLGARWKKLHRLVYAVLGLGLLHFLWIVRSDLREWAIYAFIGAVL
MVLRIPAVARALPKVAR