Protein Info for PP_4670 in Pseudomonas putida KT2440

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 151 to 176 (26 residues), see Phobius details PF17152: CHASE8" amino acids 44 to 144 (101 residues), 109 bits, see alignment E=1.3e-35 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 244 to 410 (167 residues), 161.3 bits, see alignment E=8.7e-52 PF00990: GGDEF" amino acids 248 to 405 (158 residues), 172.7 bits, see alignment E=5.3e-55

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4670)

Predicted SEED Role

"Inner membrane protein YfiN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DZ8 at UniProt or InterPro

Protein Sequence (423 amino acids)

>PP_4670 diguanylate cyclase (Pseudomonas putida KT2440)
MKPTRKRTVRPTLRSVLGRGHLSVALLAVGLAGISLTLLGVLALRVYANHNLQLIARSIN
YTVEAAVVFDDSAAANESLALIASTEEVAEAKVFNNEGEQLAHWQRDNTGMLAQLEVQVA
SALLDEPVILPIVHQQQQVGHIELAGQGRSLLLFLLSGLAGILFCTVLSALAAQYLSRRL
LSDITRPLRGLASVAHAARRERSFDRRVPEAPIAELNELGNDFNALLDELEVWHSHLQSE
NQTLAHQASHDSLTGLPNRAFFEGRLSRSVRNAARQQDHLAVLFLDSDHFKQINDTLGHA
VGDEVLISVAERVRAQLREQDLVARLGGDEFAVLLTPLHTRKDAEHIAEKIVASMELPVQ
LDSGRSVSTSLSVGIAYYPDDGADPASLLNAADAAMYQAKRERRGHWQVAQTERSANEIR
NRS