Protein Info for PP_4663 in Pseudomonas putida KT2440

Annotation: conserved transmembrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 32 to 33 (2 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 139 to 165 (27 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details PF01925: TauE" amino acids 20 to 249 (230 residues), 85.7 bits, see alignment E=2e-28

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to ppu:PP_4663)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88E05 at UniProt or InterPro

Protein Sequence (254 amino acids)

>PP_4663 conserved transmembrane protein of unknown function (Pseudomonas putida KT2440)
MTTLLAFYQNIGPALSLLVVLTFLLAGAVKGVIGLGLPTIAMGLLGLAMPPAQAAALLIV
PSTLTNLWQLASGGHLRGLLVRLGPMLALIFVGTLLGSAWLGINSGPWAAHALGGALLVY
ALYGLVGPGLQLAPGHERWLGPLCGLVTGVVTASTGVFVMPAVPYLQSLGLSREQMIQAL
GLSFTVSTLALALGLAGQDALGGQALGASLLMLAPALLGMLAGQWLRQRISALLFKRCFF
IGLAALGGHLLING