Protein Info for PP_4647 in Pseudomonas putida KT2440

Annotation: transcriptional regulator, LuxR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 PF03472: Autoind_bind" amino acids 19 to 158 (140 residues), 93.9 bits, see alignment E=7e-31 PF00196: GerE" amino acids 175 to 229 (55 residues), 54.5 bits, see alignment E=7.2e-19

Best Hits

KEGG orthology group: K07782, LuxR family transcriptional regulator (inferred from 100% identity to ppu:PP_4647)

Predicted SEED Role

"Transcriptional activator protein SolR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88E21 at UniProt or InterPro

Protein Sequence (235 amino acids)

>PP_4647 transcriptional regulator, LuxR family (Pseudomonas putida KT2440)
MLHWKPEYLRAFVSERSPQKLFDIAVHLAQDLDMDYLGLNIRIQIATQTPRLYLYSNYPS
EWIERYQRDDFYKQDPAANLSHSSTMPVLWTDELYKEAPQFREMACLYGLRHGWTQSLHD
QQHNESQISVARPNGPIDEVELYDKAGSVQWLCHTLHAVLGEHHLNALCPPQPKMSEREL
EVLKWSAAGKTAADVASILSLSQSTVNFHIRSVITKTNAANKAGAIAIAALRGWI