Protein Info for PP_4641 in Pseudomonas putida KT2440

Annotation: putative transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 688 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 163 to 186 (24 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details amino acids 368 to 388 (21 residues), see Phobius details amino acids 468 to 487 (20 residues), see Phobius details amino acids 513 to 532 (20 residues), see Phobius details amino acids 545 to 569 (25 residues), see Phobius details amino acids 576 to 598 (23 residues), see Phobius details amino acids 646 to 669 (24 residues), see Phobius details PF02554: CstA" amino acids 36 to 594 (559 residues), 870.8 bits, see alignment E=2.5e-266

Best Hits

Swiss-Prot: 72% identical to CSTA_ECOLI: Peptide transporter CstA (cstA) from Escherichia coli (strain K12)

KEGG orthology group: K06200, carbon starvation protein (inferred from 100% identity to ppu:PP_4641)

MetaCyc: 72% identical to pyruvate transporter CstA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-335

Predicted SEED Role

"Carbon starvation protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88E27 at UniProt or InterPro

Protein Sequence (688 amino acids)

>PP_4641 putative transporter (Pseudomonas putida KT2440)
MNNNNSLLRHIPWLALAVIGACALGVVALRRGEAINALWIVVAAVAIYLVAYRYYSLFIA
TKVMQLDPRRATPAVLNNDGLDYVPTNKHILFGHHFAAIAGAGPLVGPVLAAQMGYLPGT
LWLIAGVVLAGAVQDFMVLFLSTRRNGRSLGDMVREEMGRIPGTIALFGCFLIMIIILAV
LALIVVKALAESPWGMFTVMATIPIAMFMGIYMRYIRPGRIGEISVVGVVLLLASIWLGG
VIAADPVWGPAFTFTGVQITWMLVGYGFVAAVLPVWLVLAPRDYLSTFLKIGTILGLAIG
ILIIAPELKMPALTQFTDGTGPVWKGTLFPFLFITIACGAVSGFHALISSGTTPKLLDNE
TNARYIGYGGMLMESFVAIMAMVAASVIEPGVYFAMNSPAAVVGTDVASVAQTVSSWGFL
ITPEQLEAVARDIGEHTILARAGGAPTLAVGIAQILHQVLPGENTMAFWYHFAILFEALF
ILTAVDAGTRAGRFMLQDLLGSFVPALKRTESWGANLLATAGCVALWGYLLYQGVIDPLG
GINTLWPLFGISNQMLAGIALMLGTVVLIKMKRQRYIWVTLLPAVWLLICTTAAGLIKLF
DPNPAVGFLALAKKYSTALDAGQVLAPAKDIGQMQHVIFNAYTNAGLTILFLLVVFSILF
FAIKVGYAALGRKERSDKETPFQALPDA