Protein Info for PP_4635 in Pseudomonas putida KT2440

Annotation: trans-2-enoyl-CoA reductase (NAD(+))

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12242: Eno-Rase_NADH_b
  • amino acids 3 to 81 (79 residues), 118.4 bits, E=1.4e-38
• PF12241: Enoyl_reductase
  • amino acids 83 to 320 (238 residues), 360.6 bits, E=5.1e-112
• PF07055: Eno-Rase_FAD_bd
  • amino acids 329 to 392 (64 residues), 107.4 bits, E=5.9e-35

Best Hits

Swiss-Prot: 100% identical to FABV_PSEPK: Enoyl-[acyl-carrier-protein] reductase [NADH] (fabV) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K10783, trans-2-enoyl-CoA reductase (NAD+) [EC: 1.3.1.44] (inferred from 100% identity to ppf:Pput_4497)

Predicted SEED Role

"Short-chain alcohol dehydrogenase family"

MetaCyc Pathways

• pyruvate fermentation to hexanol (engineered) (8/11 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• L-leucine degradation IV (reductive Stickland reaction) (2/5 steps found)

KEGG Metabolic Maps

• Butanoate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.44

Sequence Analysis Tools

See Q88E33 at UniProt or InterPro

Protein Sequence (403 amino acids)

>PP_4635 trans-2-enoyl-CoA reductase (NAD(+)) (Pseudomonas putida KT2440)
MAIIHPKVRGFICTTTHPKGCELNVRDQIEATRKLGVREDGPKKVLVIGASSGYGLAARI
TAAFGFKADTLGVFFEKPGTETKAGTAGWYNAAAFDKFAKAEGLYSKSINGDAFSDEARA
KVIELIKNEMGGKVDLVIYSLASPVRKLPQTGEVIRSALKPIGQPYKSTAIDTNKDTIIE
ASIEPATEQEIADTVTVMGGQDWQLWIDALAGANVLAEGARTVAFSYIGSDITWPIYWHG
ALGQAKQDLDETALRLNQKLAGEVKGGANVAVLKSVVTQASSAIPVMPLYLSMVFKIMQE
KGVHEGTQDQLDRMYRDRMYRTDGAPAEVDEKGRLRLDDWELRDDVQNACKALWPQVTTE
NLFELTDYAGYKKQFLNLFGFERADVDYDKDVATDVKFDCVEL