Protein Info for PP_4629 in Pseudomonas putida KT2440

Annotation: Sensory box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 TIGR00229: PAS domain S-box protein" amino acids 5 to 129 (125 residues), 71.4 bits, see alignment E=3.9e-24 PF00989: PAS" amino acids 6 to 119 (114 residues), 47 bits, see alignment E=6e-16 PF13188: PAS_8" amino acids 6 to 64 (59 residues), 31 bits, see alignment E=4.5e-11 PF08448: PAS_4" amino acids 11 to 120 (110 residues), 24.6 bits, see alignment E=6.1e-09 PF13426: PAS_9" amino acids 16 to 120 (105 residues), 74.7 bits, see alignment E=1.6e-24 PF08447: PAS_3" amino acids 31 to 115 (85 residues), 35 bits, see alignment E=3.5e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4629)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88E39 at UniProt or InterPro

Protein Sequence (142 amino acids)

>PP_4629 Sensory box protein (Pseudomonas putida KT2440)
MINAQLLQSMVDASNDGIVVAEKEGDDTILIYVNAAFEYLTGYSRDEILYQDCRFLQGDD
RDQLGRARIRKAMAEGRPCREVLRNYRKDGSAFWNELSITPVKSDFDQRTYFIGIQKDVS
RQVELERELAELRARPKPDERA