Protein Info for PP_4626 in Pseudomonas putida KT2440

Annotation: holin regulator of murein hydrolases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details PF03788: LrgA" amino acids 24 to 116 (93 residues), 88.7 bits, see alignment E=1e-29

Best Hits

Swiss-Prot: 32% identical to CIDA1_BACAN: Holin-like protein CidA 1 (cidA1) from Bacillus anthracis

KEGG orthology group: K06518, holin-like protein (inferred from 100% identity to ppu:PP_4626)

Predicted SEED Role

"Holin-like protein CidA" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88E42 at UniProt or InterPro

Protein Sequence (128 amino acids)

>PP_4626 holin regulator of murein hydrolases (Pseudomonas putida KT2440)
MKPALLKKALRLLVELAVLCALFLLGGQIASWLGWPIPGGVMGLALLLILFASGVLKPAM
LQLGAGWLMAEMLLFFIPALMSLLDYGALIREEGWRILLVIAVSTLIVMIVTAMTVEMVC
RWRLRREP