Protein Info for PP_4619 in Pseudomonas putida KT2440

Annotation: Maleylacetoacetate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF02798: GST_N" amino acids 2 to 74 (73 residues), 53 bits, see alignment E=7e-18 TIGR01262: maleylacetoacetate isomerase" amino acids 3 to 207 (205 residues), 288.3 bits, see alignment E=1.7e-90 PF13417: GST_N_3" amino acids 3 to 80 (78 residues), 58.9 bits, see alignment E=9.9e-20 PF13409: GST_N_2" amino acids 10 to 75 (66 residues), 60.9 bits, see alignment E=3e-20 PF13410: GST_C_2" amino acids 135 to 173 (39 residues), 29.3 bits, see alignment 1.5e-10

Best Hits

Swiss-Prot: 76% identical to MAAI_PSEAE: Maleylacetoacetate isomerase (maiA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01800, maleylacetoacetate isomerase [EC: 5.2.1.2] (inferred from 99% identity to ppf:Pput_4479)

MetaCyc: 52% identical to glutathion-dependent maleylpyruvate isomerase (Ralstonia sp. U2)
Maleylpyruvate isomerase. [EC: 5.2.1.4]

Predicted SEED Role

"Maleylacetoacetate isomerase (EC 5.2.1.2) @ Glutathione S-transferase, zeta (EC 2.5.1.18)" (EC 2.5.1.18, EC 5.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18 or 5.2.1.2 or 5.2.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88E49 at UniProt or InterPro

Protein Sequence (210 amino acids)

>PP_4619 Maleylacetoacetate isomerase (Pseudomonas putida KT2440)
MELYTYYRSTSSYRVRIALALKGLAYQSLPVNLLQGEQRGEGYVAVNPQGRVPALRTDGG
EVLVQSPAIIEYLEEVYPQPALLPATAEARARVRGVAAIIGCDIHPLHNVSVLNRLRQAG
QDEGQVNQWIGHWISQGLAAVEQLIGDHGFCFGDTPGLADVYLIPQLYAAERFNIDLDSF
PRILRVAALAAAHPAFAKAHPAQQPDSPAQ