Protein Info for PP_4611 in Pseudomonas putida KT2440

Annotation: RNA polymerase sigma-70 factor, ECF subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 16 to 162 (147 residues), 61.6 bits, see alignment E=3.6e-21 PF04542: Sigma70_r2" amino acids 18 to 83 (66 residues), 57.8 bits, see alignment E=1.5e-19 PF07638: Sigma70_ECF" amino acids 41 to 162 (122 residues), 38.4 bits, see alignment E=2.5e-13 PF08281: Sigma70_r4_2" amino acids 114 to 166 (53 residues), 54.2 bits, see alignment E=1.8e-18 PF04545: Sigma70_r4" amino acids 119 to 166 (48 residues), 26.7 bits, see alignment E=6.2e-10

Best Hits

Swiss-Prot: 46% identical to FECI_ECOLI: Probable RNA polymerase sigma factor FecI (fecI) from Escherichia coli (strain K12)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to ppu:PP_4611)

MetaCyc: 46% identical to RNA polymerase sigma factor FecI (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"FIG006045: Sigma factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88E57 at UniProt or InterPro

Protein Sequence (170 amino acids)

>PP_4611 RNA polymerase sigma-70 factor, ECF subfamily (Pseudomonas putida KT2440)
MRRSITVTSALTSTVEGLYHAHHNWLTGWLRRRLGCPHSAADLAQDTYMRLLQAREAPQL
VEPRAFLATVAKRVLCNHFRRQELERAYLQALAQVPEEVAPCEEQKAIIFETLLALDHLL
DGLPPLVKRAFLLAQVDGLGQGEIARELGISLATVKRYLNKAAMRCYFAL