Protein Info for PP_4606 in Pseudomonas putida KT2440

Annotation: putative Outer membrane ferric siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 796 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF07660: STN" amino acids 58 to 107 (50 residues), 32.1 bits, see alignment 1.2e-11 PF07715: Plug" amino acids 144 to 242 (99 residues), 77.4 bits, see alignment E=1.8e-25 TIGR01783: TonB-dependent siderophore receptor" amino acids 146 to 796 (651 residues), 388.6 bits, see alignment E=3.2e-120 PF00593: TonB_dep_Rec_b-barrel" amino acids 317 to 765 (449 residues), 249 bits, see alignment E=2.7e-77

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to ppu:PP_4606)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88E62 at UniProt or InterPro

Protein Sequence (796 amino acids)

>PP_4606 putative Outer membrane ferric siderophore receptor (Pseudomonas putida KT2440)
MKFTPRCVPLWFGLAALPAFAVAPLATAAEQLQAYAFAQPAQPLAQALNAFSRTTGQSVV
YTLELPGVQAPALNGRFSAEQALQQLLGNAGLAWRRVDARTLTLEPADTSGALSLQATTV
TSQLDDYSYQPPASASIMRGQGPNQDIPQAINVVPAQVIRDQAPRNLDDALANVSGITQG
NNFGGTSDTVMKRGFGDNRDGSIMRDGMPVVQGRNLNASTERVEVLKGPASLLYGIQDPG
GVINVVSKRPQLQQYNALTVRGSTYGSGKNGSGGGLDSTGALGDSNFAYRLVVDHEDEDY
WRNYGVHRESLVAPSLAWLGEDTQVVLAYEHREFLYPFDRGTAFGNNGHPLNIPATRRLD
EPFNDMEGRSDLYRLEVDHQLADDWKLHFGYSFNRETYDASQVRVTGVNETQGTLTRSID
GTHNAMSRDQFVTLSLNGNVELAGMQHDLLFGIDHEDRKIFRGDLIRQTPQSTFSYLDPV
YGQEVEGTNVRASDSDQTDKLRTDALFVQDALHLDEHWILVAGARFQQYDQYAGRGRPFK
ANTDISGQAWVPHAGIVYKVDDQLSFYGSYSESFKPNSTIAPLTGNVVLDSSVAPEEGKA
WELGAKLDMPGRITGTLALFDITKRNVLVSNFDAVTSETVYSNAGEVSSRGVELDVTGQL
SERWSLIGSYALTDAKVTKDPDLEGNRLQNVARHSGSLSAVYDFGSLFGSDRLRFGAGAR
YVGERSGNATNTFDLPSYTVADAFATYETKLDEHNVRLQLNVKNLFDKVYYSSAVNQYFV
AIGDARQVSLSSTFEF