Protein Info for PP_4604 in Pseudomonas putida KT2440

Annotation: putative permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 212 to 235 (24 residues), see Phobius details amino acids 243 to 260 (18 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details PF00892: EamA" amino acids 5 to 134 (130 residues), 41.5 bits, see alignment E=8.1e-15 amino acids 149 to 285 (137 residues), 48.2 bits, see alignment E=6.9e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4604)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88E64 at UniProt or InterPro

Protein Sequence (300 amino acids)

>PP_4604 putative permease of the drug/metabolite transporter (DMT) superfamily (Pseudomonas putida KT2440)
MNLSLYLLTVLIWGTTWIALKLQLGVVAIPVSIVYRFALAGLILFAFLLITRRLQPMNRR
GHQICLAQGLCLFCVNFICFLSASQWIASGLIAVVFSTATLWNALNARIFFGQRIAGNVL
GGGALGLLGLGLLFWPELSHHAASRETLYGLGLALLGTLCFSAGNMLSSMQQKAGLKPMT
TNAWGMVYGAVMLAVFCVVSGVPFSMEWNARYIGSLLYLVVPGSVIAFTAYLTLVGRMGP
ERAAYCTVLFPLVALNVSAVAEGYQWTAPALLGLVAVMAGNVLVFRKPRARVAEGVVVAK