Protein Info for PP_4594 in Pseudomonas putida KT2440

Annotation: putative Cystathionine gamma-synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01053: Cys_Met_Meta_PP
  • amino acids 14 to 388 (375 residues), 445.9 bits, E=8.9e-138
• PF00155: Aminotran_1_2
  • amino acids 75 to 234 (160 residues), 25.9 bits, E=5.8e-10

Best Hits

Swiss-Prot: 47% identical to METC_COXBU: Cystathionine beta-lyase (metC) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K01758, cystathionine gamma-lyase [EC: 4.4.1.1] (inferred from 100% identity to ppf:Pput_1294)

MetaCyc: 43% identical to cystathionine gamma-lyase (Helicobacter pylori 26695)
Cystathionine gamma-lyase. [EC: 4.4.1.1]

Predicted SEED Role

"Cystathionine gamma-lyase (EC 4.4.1.1)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.4.1.1)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• glycine betaine degradation III (7/7 steps found)
• L-cysteine degradation II (3/3 steps found)
• L-methionine degradation II (3/3 steps found)
• L-serine degradation (3/3 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• glycine betaine degradation I (6/8 steps found)
• D-serine degradation (2/3 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• L-threonine degradation I (4/6 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (4/6 steps found)
• L-cysteine biosynthesis III (from L-homocysteine) (1/2 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (3/5 steps found)
• homocysteine and cysteine interconversion (2/4 steps found)
• superpathway of L-threonine metabolism (12/18 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• hydrogen sulfide biosynthesis II (mammalian) (1/6 steps found)
• superpathway of L-methionine salvage and degradation (8/16 steps found)
• hypoglycin biosynthesis (4/14 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism
• Methionine metabolism
• Nitrogen metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.1

Sequence Analysis Tools

See Q88E72 at UniProt or InterPro

Protein Sequence (393 amino acids)

>PP_4594 putative Cystathionine gamma-synthase (Pseudomonas putida KT2440)
MGLTMSDKPRNFATRTIHAGEQFSVADNAIFPAIVTASSFTKRSLDDKPEYSYSRVGNPT
RHAYETCVAALEEGVGAVACASGVNATATVLELLPKDAHVVVMNGVYGGTFRIMEDYRSR
TSGLTTTYVDLNDIEAVAAAIKPETQLIWIESPTNPLLHLVDIKAVCDLAKAKGILTCID
NTFCSPWNQRPITLGVDLVMHSASKYIGGHSDLTGGVVVAANDALLARLRRISMAIGAVQ
GPFDCYLALRGLKTLDVRMERQCANALQVARFLEGHAQVEQVYYPGLESHPQHELCKRQM
RSGGAVVAMKVKGDRAALNRLVEALQIFVLADSLGGVESMINHSWSMSHCSLSPEQKGVM
GISENLLRLSVGIEDYRDLVEDLDGALKALVAV