Protein Info for PP_4578 in Pseudomonas putida KT2440

Annotation: Major facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 44 to 63 (20 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 309 to 326 (18 residues), see Phobius details amino acids 332 to 358 (27 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details amino acids 395 to 417 (23 residues), see Phobius details PF07690: MFS_1" amino acids 38 to 294 (257 residues), 125.9 bits, see alignment E=1.8e-40 amino acids 285 to 422 (138 residues), 36 bits, see alignment E=4.1e-13 PF00083: Sugar_tr" amino acids 64 to 211 (148 residues), 76.3 bits, see alignment E=2.5e-25 amino acids 276 to 426 (151 residues), 31.6 bits, see alignment E=8.4e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4578)

Predicted SEED Role

"Sialic acid transporter (permease) NanT" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88E88 at UniProt or InterPro

Protein Sequence (428 amino acids)

>PP_4578 Major facilitator family transporter (Pseudomonas putida KT2440)
MNPTGVQQQVSTLPSSGPFAWYRDIDKQQRRTFWSCKIGYGLDGMDTQMLSFVIPTLIML
WGITTTEAGLIHTSTLIASAVGGWVAGILSDRIGRVRTLQLTVLWFAFFTFLCGFAQNYE
QLLIARTLMGFGFGGEWTAGAVLIGEVIRAQDRGKAVGMVQSGWAIGWGLTAILYALLFS
WLPAEQAWRALFLLGLVPAIFVIFVRRLVKDPEVYRKAKAVENAEAPSRFYEIFAPGMLW
TTVRASLLTTGALGGYYAITSWLPTFLKNERGLSVLGTGGYLAMVIVGSYMGYVVSAYLS
DLLGRKKNFILFAVGSFVIVLLYTQMPVSDGVMLWLGLPLGFFASGIFSGMGAFLTELFP
TRIRGSGQGFCYNIGKVIAALFPLMIGMLGQNVPLGLGIGVFSAVSYGIVIVAALSLPET
RGKQLQAR