Protein Info for PP_4568 in Pseudomonas putida KT2440

Annotation: putative metabolite efflux pump

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 41 to 62 (22 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 266 to 283 (18 residues), see Phobius details PF00892: EamA" amino acids 15 to 140 (126 residues), 33.5 bits, see alignment E=2.4e-12 amino acids 152 to 283 (132 residues), 45.9 bits, see alignment E=3.6e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_1321)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88E98 at UniProt or InterPro

Protein Sequence (293 amino acids)

>PP_4568 putative metabolite efflux pump (Pseudomonas putida KT2440)
MSVFTKTSVASAATTCLFVLLWSSGAIVSKLGLAHASPFAFLLLRSALALAGLLLIGPLL
GLRWPRTRGSILRALGTGCVLLGAYQIFYLLALDTHVTPGVMATVMGVQPILTVVLMERQ
RSWSRLFGLGLGLGGLIMVVYQGINLGGVSLAGMLFALLALVSMTFGSILQKRITDNPMG
TLPLQYLAGFAMCALFAPLQPLHVEWTGSFVGALLWMGLVVSLLATLLLYRLIAKGNLVN
VTSLFYLVPAVTAVMDLLIFGNRLAPLSLLGMGLIVVGLLFVFRKPAARLAEA