Protein Info for PP_4566 in Pseudomonas putida KT2440

Annotation: putative drug/metabolite transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 36 to 54 (19 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 269 to 286 (18 residues), see Phobius details PF00892: EamA" amino acids 9 to 136 (128 residues), 60.6 bits, see alignment E=1e-20 amino acids 150 to 286 (137 residues), 68.7 bits, see alignment E=3.2e-23

Best Hits

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_1323)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EA0 at UniProt or InterPro

Protein Sequence (291 amino acids)

>PP_4566 putative drug/metabolite transporter (Pseudomonas putida KT2440)
MSPIALARLLTLAAVWGASFLFMRIIAPELGTVPTAFFRVSIACLGLIVILAAARVRWNF
QGKLGACLVLGMINSGIPATFYSVAAQVLPAGYSAIFNATTPLMGVLVGVLFFREPMTLA
KLCGIFLGLFGVGILSGAGPVALDMALLQGALACLAATTCYGFAGFLARRWISGLDSRLS
ALGSMLGATLMLTPLFGWSALTQPPASWGGWEVWLSLLGLGLLCTAFAYILYFRLLEEIG
PVKASTVTFLIPVFGVLWGAWLLNEPLSMAHLYGGLLIGLALWLVLRPARS