Protein Info for PP_4541 in Pseudomonas putida KT2440

Annotation: peptidyl-prolyl cis-trans isomerase A (rotamase A)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00160: Pro_isomerase" amino acids 27 to 182 (156 residues), 162.5 bits, see alignment E=4.9e-52

Best Hits

Swiss-Prot: 63% identical to PPIA_PSEAE: Peptidyl-prolyl cis-trans isomerase A (ppiA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03767, peptidyl-prolyl cis-trans isomerase A (cyclophilin A) [EC: 5.2.1.8] (inferred from 100% identity to ppf:Pput_1349)

MetaCyc: 61% identical to peptidyl-prolyl cis-trans isomerase A (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase PpiA precursor (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EC5 at UniProt or InterPro

Protein Sequence (185 amino acids)

>PP_4541 peptidyl-prolyl cis-trans isomerase A (rotamase A) (Pseudomonas putida KT2440)
MLKKLLLTACSVAFATSVMASDKTPHVLLDTSFGQVEIELNAEKAPLSTKNFLQYVDSGF
YNNTIFHRVIPGFMVQGGGFTDQMVQKNTNDPIKNEASNGLQNTRGTLSMARTSNPNSAT
SQFFINVADNDFLNPGRDAGYAVFGKVTKGMEVVDQIVNSPTTIKKGMRDVPADPVYIKS
AKRID