Protein Info for PP_4527 in Pseudomonas putida KT2440

Annotation: putative permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 43 to 60 (18 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details PF00892: EamA" amino acids 15 to 142 (128 residues), 60.9 bits, see alignment E=8.3e-21 amino acids 158 to 294 (137 residues), 64.2 bits, see alignment E=7.7e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4527)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88ED8 at UniProt or InterPro

Protein Sequence (308 amino acids)

>PP_4527 putative permease of the drug/metabolite transporter (DMT) superfamily (Pseudomonas putida KT2440)
MSAVRKNPDAFAFQVMLGLCLIWGCQQVLIKTAAVDIAPVMQAALRNGIAAVLVGLMLCW
RGGWEQVGSTWRAGLVAGGLFGVEFLFIAEGLKLTSAAHMSVFLYTAPVFTALGLHFRLP
SERLRLLQWLGILLAFGGIAMAFAGGSSFEHMDGRTLLGDAFGVIAGLAWGATTVVVRCS
RLSEAPATLTLFYQLAVGFAGLLLIALLSGQIGAVSLTPLAMGSVLFQGIVVSFISYLTW
FWLLRKYLASNLAVFSFITPLFGVTFGVLLLDEPLSANFVVGALMVLLGVILVSAEPWVK
QQLRRLVG