Protein Info for PP_4514 in Pseudomonas putida KT2440

Annotation: putative esterase of the alpha-beta hydrolase superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 728 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01734: Patatin" amino acids 29 to 221 (193 residues), 126.1 bits, see alignment E=3e-40 PF07244: POTRA" amino acids 333 to 400 (68 residues), 22.4 bits, see alignment E=2.4e-08 PF01103: Omp85" amino acids 448 to 728 (281 residues), 38 bits, see alignment E=2.1e-13

Best Hits

KEGG orthology group: K07001, (no description) (inferred from 100% identity to ppu:PP_4514)

Predicted SEED Role

"putative patatin-like phospholipase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EF1 at UniProt or InterPro

Protein Sequence (728 amino acids)

>PP_4514 putative esterase of the alpha-beta hydrolase superfamily (Pseudomonas putida KT2440)
MRRLLFCFLLVLTSLTAIAAEPARPKVGLVLSGGAARGLAHIGVLKALEEQGVRIDAIAG
TSMGAVVGGLYASGYSVEELEKLATTLDWQQALSDAPPREDVPFRRKQDDRDFLVKQKLS
FRDDGSLGLPLGVIQGQNLSLLLESKLAHTADTRDFDKLPIPFRAVATDIASGEKVVFRR
GHLPQVIRASMSIPAVFAPVELDGRLLVDGGMVDNIPVDVAREMGVDLAIVVDIGTPLRD
RKQLLTVVDVLNQSITLMTRRNSEEQLASLHRDDILIQPSLTAFGVTDFGRARHMIDAGY
RATRLLDPRLAALRQLEGDASLAVARSPRQRTPVITAIRIENDSKVSDDVIRSYIRQPID
APLELDRLQTDMGTLYGLDYFDRVQYRVVHKGNDHTLVINARGRRGGTDYLRLGLNLSDD
LRGDSAFNLGASYRVNGINSLGAEWLTRGQIGDQQALYSEFYQPLDVGSRYFIAPYLDLG
SQNIEATLDNDPVAEYRLERYGFGLNVGRQIGNSGEVRLGVGKAWGEAEVRIGDQDLPKV
SFNEGFYELKYSFDTLDNVYFPHHGEDIGLTLRKYDKSLDSDQDYRQWLFTLDKAISSGP
NTFVLGGSYGRTLDDTEVVTSSFVMGGARQLSGFREDSVSGQNASLLRMVYYRRLTPRAY
VPLDFPLYIGGSLERGRAWNNDNEFDSGYINAASIFLGLDTPLGPLNFSYGANSAHEQAV
YLNLGHTF