Protein Info for PP_4505 in Pseudomonas putida KT2440

Annotation: Sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 149 to 174 (26 residues), see Phobius details PF00672: HAMP" amino acids 170 to 223 (54 residues), 29.8 bits, see alignment 1.2e-10 PF00512: HisKA" amino acids 229 to 292 (64 residues), 49.7 bits, see alignment E=6e-17 PF02518: HATPase_c" amino acids 336 to 441 (106 residues), 83.4 bits, see alignment E=3.1e-27 PF13581: HATPase_c_2" amino acids 341 to 416 (76 residues), 28.7 bits, see alignment E=2.4e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4505)

Predicted SEED Role

"Putative two-component system sensor kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EG0 at UniProt or InterPro

Protein Sequence (446 amino acids)

>PP_4505 Sensor histidine kinase (Pseudomonas putida KT2440)
MHLRSLFWRILASFWLAITLVAGLSILLGHMLNQDAWILSRHPGLNTLASKWTKHYEQEG
LEAAQHFLERRKNRYKIDVQVLDDSGEAVVPGTFPRRAAALEARQHNDQRRLPWRRLTEE
YTSPDTGETYLLIYRIPHPALDAWHRESLLWPLSALGIALVVLTLFSLLVTLSITRPLSR
LRSAVHDLGQTTYQQNSLARLAARRDEFGVLAKDFNKMGARLQSTIGSQRQLLRDVSHEL
RSPLARLRIALALAERAEPEQRQALWPRLTRECDRLEDLISEILALARVDAEQAHAEPVD
LNALLGSVRKDALLSAPDQDVRLEAQPGLSLQGWPTLIERAVDNLLRNALRFNPAGQPVE
VSAAREQDRIVISVRDHGPGAAEEHLAQLGEPFFRAPGQEAPGHGLGLAIARKAAERHGG
SLMLENHPQGGFVARLELPLAGAAGS