Protein Info for PP_4502 in Pseudomonas putida KT2440

Annotation: putative enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 PF03795: YCII" amino acids 12 to 106 (95 residues), 103.2 bits, see alignment E=4.4e-34

Best Hits

Swiss-Prot: 70% identical to YCII_SHIFL: Protein YciI (yciI) from Shigella flexneri

KEGG orthology group: K09780, hypothetical protein (inferred from 99% identity to ppg:PputGB1_4008)

Predicted SEED Role

"YciL protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EG3 at UniProt or InterPro

Protein Sequence (110 amino acids)

>PP_4502 putative enzyme (Pseudomonas putida KT2440)
MTLLPPNPRIDMLYAIIASDVANSLEKRLAARPAHIERLQQLKAEGRVVLAGPHPAIDSN
DPGEAGFSGSLIVAEFESLAAAQTWADADPYIAAGVYDKVVVKPFKQVLP