Protein Info for PP_4495 in Pseudomonas putida KT2440

Annotation: aromatic amino acid transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 196 to 220 (25 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 284 to 309 (26 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 370 to 388 (19 residues), see Phobius details amino acids 409 to 431 (23 residues), see Phobius details amino acids 437 to 455 (19 residues), see Phobius details PF00324: AA_permease" amino acids 19 to 460 (442 residues), 410.5 bits, see alignment E=9e-127 PF13520: AA_permease_2" amino acids 23 to 447 (425 residues), 111.8 bits, see alignment E=4e-36

Best Hits

Swiss-Prot: 66% identical to AROP_ECOL6: Aromatic amino acid transport protein AroP (aroP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 100% identity to ppf:Pput_1417)

MetaCyc: 66% identical to aromatic amino acid:H+ symporter AroP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56; TRANS-RXN-76; TRANS-RXN-77

Predicted SEED Role

"Aromatic amino acid transport protein AroP" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EG8 at UniProt or InterPro

Protein Sequence (472 amino acids)

>PP_4495 aromatic amino acid transport protein (Pseudomonas putida KT2440)
MSGQNMHSGELKRGLKNRHIQLIALGGAIGTGLFLGSAGVMKSAGPSMILGYAICGFIAF
MIMRQLGEMIVEEPVAGSFSHFAHTYWGGFAGFLSGWNCWVLYILVGMSELSAVGKYVHY
WWPEIPTWVTAAAFFVLINAINLMNVKFFGEAEFWFAIIKVVAIVSMIGLGAYLLTSGSG
GPEATVANLWTHGGFFPNGVSGLVMALAFIMFSFGGLEMLGFTAAEADKPKTVIPKAINQ
VIYRILIFYVGALVVLLSLTPWDNLVASIDASGGSYGSSPFVQVFSLLGSDVAANLLNFV
VLTAALSVYNSGTYCNARMLLGMAEQGDAPASLAKVDKRGVPVRSILVSAAVTFVAVLLN
YLMPQNALELLMSLVVATLVINWAMISYSHLKFRQHLDRTGQKPLFKALWYPYGNYVVLA
FVVLILGIMLMIPGIQVSVYAIPVWLLAMLVVYMVKSRRQVNAGGAVETVAK