Protein Info for PP_4486 in Pseudomonas putida KT2440

Annotation: lysine / arginine / ornithine ABC transporter - periplasmic binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01096: lysine-arginine-ornithine-binding periplasmic protein" amino acids 4 to 251 (248 residues), 286.4 bits, see alignment E=9.7e-90 PF00497: SBP_bac_3" amino acids 26 to 252 (227 residues), 135.1 bits, see alignment E=1.3e-43 PF10613: Lig_chan-Glu_bd" amino acids 64 to 117 (54 residues), 31.1 bits, see alignment E=2.2e-11

Best Hits

Swiss-Prot: 44% identical to ARGT_ECOLI: Lysine/arginine/ornithine-binding periplasmic protein (argT) from Escherichia coli (strain K12)

KEGG orthology group: K10022, arginine/ornithine transport system substrate-binding protein (inferred from 100% identity to ppf:Pput_1429)

Predicted SEED Role

"Arginine/ornithine ABC transporter, periplasmic arginine/ornithine binding protein" in subsystem Arginine and Ornithine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EH7 at UniProt or InterPro

Protein Sequence (261 amino acids)

>PP_4486 lysine / arginine / ornithine ABC transporter - periplasmic binding protein (Pseudomonas putida KT2440)
MKKLALLGALALSVFSLVSQAAEKPLKIGIEAAYPPFAFKQPDGSIAGFDYDIGNALCEE
MKTKCTWVEQEFDGLIPALKVRKIDAILSSMSITDDRKKSVDFTKRYYLTPARLVMKDGT
TVSDSLDELKGKKIGVQRGSIHDRFAKEVLGAKGATVVPYGTQNEIYLDVAAGRLDGTVA
DATLLEDGFLKTDAGKGFAFVGPAFTDAKYFGDGIGIAVRKGDKANVDRINAAIDAIRAN
GKYKEIESKYFNFDIYGPDSK