Protein Info for PP_4477 in Pseudomonas putida KT2440

Annotation: N-succinylarginine dihydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 PF04996: AstB" amino acids 3 to 446 (444 residues), 742.2 bits, see alignment E=9.6e-228 TIGR03241: succinylarginine dihydrolase" amino acids 3 to 446 (444 residues), 843.2 bits, see alignment E=2.6e-258

Best Hits

Swiss-Prot: 100% identical to ASTB_PSEPK: N-succinylarginine dihydrolase (astB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01484, succinylarginine dihydrolase [EC: 3.5.3.23] (inferred from 100% identity to ppu:PP_4477)

MetaCyc: 60% identical to N-succinylarginine dihydrolase (Escherichia coli K-12 substr. MG1655)
N-succinylarginine dihydrolase. [EC: 3.5.3.23]

Predicted SEED Role

"Succinylarginine dihydrolase (EC 3.5.3.23)" in subsystem Arginine and Ornithine Degradation (EC 3.5.3.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EI5 at UniProt or InterPro

Protein Sequence (449 amino acids)

>PP_4477 N-succinylarginine dihydrolase (Pseudomonas putida KT2440)
MKSYEVNFDGLVGPTHNYGGLSYGNVASQSNSQQASNPREAARQGLAKMKALADMGFKQG
VLAPQERPDVAALRRLGFSGSDAEVIQRAAREAMPLLVASCSASSMWVANAATVSPSADT
ADGRVHFTAANLNCKYHRSIEHPTTSRVLGAMFNDEKYFAHHAALPAVAQFGDEGAANHT
RFCRAYGEAGVEFFVYGRSAFDSRYPAPQKYPARQTLEASQAVARLHGLSDDGVVYAQQN
PAVIDQGVFHNDVISVGNGEVLFYHEDAFLETDAVLGQLRAKLASKGGNFQAICVPRAAV
AVEDAVRSYLFNSQLLSREDGSMLLVVPEECRNNERVWAYLGQLTSQGGPVKEVKVFDLK
QSMQNGGGPACLRLRVALKEAELAAVNQGVIMTATLYDTLLQWVDRHYRDRLGEADLADP
QLLVECRTALDELTQILKLGSVYPFQRQP