Protein Info for PP_4455 in Pseudomonas putida KT2440

Annotation: glutathione ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 5 to 11 (7 residues), see Phobius details amino acids 27 to 31 (5 residues), see Phobius details transmembrane" amino acids 12 to 26 (15 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 134 to 158 (25 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 280 to 306 (27 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 76 (76 residues), 52.9 bits, see alignment E=4.1e-18 PF00528: BPD_transp_1" amino acids 113 to 311 (199 residues), 145.2 bits, see alignment E=1.9e-46

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to ppu:PP_4455)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EK7 at UniProt or InterPro

Protein Sequence (313 amino acids)

>PP_4455 glutathione ABC transporter permease subunit (Pseudomonas putida KT2440)
MIQFAIKRLMLAIPTLLAMLTAVFVLVRLVPGDPAAVILGDQASAESLAAMREQLGLNQP
IAMQYIHFLGDMLSGNFGVSMTSGRTVLQEVSLVLPWTLQLTFASVLIGLVFGLPLGVWA
ALRRNAWPDYVGRILSLTGLSFPAFVSAMLMLLVFAIHFRWFPVIGSLVDGGFLSQLHAL
TLPALNLGLIMTAYVMRVTRSSMISVLGEDYIRTAKAKGVRPMRLVLRHGLRNALIPIVT
VVGLYFGTLIGNSVLTEIVFNRPGLGKLILGALNTRDYTLLQGLMVVFALCVIVVNIITD
IVYGLVDPRVKIK