Protein Info for PP_4453 in Pseudomonas putida KT2440

Annotation: glutathione ABC transporter ATP-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 PF00005: ABC_tran" amino acids 32 to 191 (160 residues), 107.6 bits, see alignment E=2.8e-34 amino acids 336 to 483 (148 residues), 108.6 bits, see alignment E=1.4e-34 PF13304: AAA_21" amino acids 159 to 226 (68 residues), 28 bits, see alignment E=7.6e-10 PF08352: oligo_HPY" amino acids 242 to 271 (30 residues), 28.3 bits, see alignment (E = 6.8e-10) amino acids 535 to 571 (37 residues), 36.7 bits, see alignment 1.6e-12

Best Hits

Swiss-Prot: 58% identical to GSIA_ECO57: Glutathione import ATP-binding protein GsiA (gsiA) from Escherichia coli O157:H7

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to ppu:PP_4453)

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EK9 at UniProt or InterPro

Protein Sequence (610 amino acids)

>PP_4453 glutathione ABC transporter ATP-binding subunit (Pseudomonas putida KT2440)
MNGSLPLNQETVLEVTGLNVAFRRGGGWSPVVKDLSFRVARGETLAIVGESGSGKSVSAM
SILGLLPANTSQVTGSIRLQGQELLCLPEPEMADIRGNRIAMIFQEPMTSLNPVMTIGEQ
IAEPLRLHRGLDATQAKEEALKLMERVRIPAAQERYDDYPHQFSGGMRQRVMIAMALACN
PAVLIADEPTTALDVTIQAQILELIKELQAQEHMAVVFITHDMGVVAQIADRTLVMYRGD
LVETASTSEIFSAPQKPYTKALLSAVPELGSMAAEPSPKPFPIYDMAAGSNVPAPEMKDS
VRHTKPYLLEVSGLTTRFDVRSGFFKRVTGRVHAVENVSFNLSQGETLAIVGESGCGKST
TGRLITGLLDPTHGSVKLEGVELGSITPMERARKIQMVFQDPYSSLNPRQTVAQSIIEPL
RVHGLYDAKRCEEVAIELLVKVGLPADAAWRLPHEFSGGQRQRVCIARALALRPGTIVAD
EAVSALDVSVKVQIVNLLLELQQELGLGFIFISHDMAVVERVSHRVAVMYMGEIVEIGPR
AAIFNDPKHPYTRRLIDAVPIPDPARKQVQRVSAGTLRTPYKAHDFIPPARVYHQAGEGH
FYMEPEGEWC