Protein Info for PP_4433 in Pseudomonas putida KT2440

Annotation: Amino acid MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 39 to 58 (20 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 293 to 310 (18 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details amino acids 348 to 370 (23 residues), see Phobius details amino acids 380 to 398 (19 residues), see Phobius details amino acids 416 to 434 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 28 to 440 (413 residues), 133.8 bits, see alignment E=1.3e-42 PF07690: MFS_1" amino acids 49 to 338 (290 residues), 111.3 bits, see alignment E=7.5e-36 amino acids 264 to 434 (171 residues), 35.6 bits, see alignment E=7.9e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4433)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EM1 at UniProt or InterPro

Protein Sequence (450 amino acids)

>PP_4433 Amino acid MFS transporter (Pseudomonas putida KT2440)
MSISTHPASTISSSTIKSLNMSMPRKAVVAAALGNATEWFDYGIYAYGLTFISAALFPGS
QSEALYFGLATFAISFLIRPLGGMFWGPLGDRIGRKRVLAMTVLMMSVATFIIGILPTYQ
SVGWIAPVALIALRLIQGFSTGGEYGGAATFLAEYAPDKRRGFYGSFLEFGSLAGFSLGA
LVTLSVSVVIGDAAMYEWGWRVPFLIAAPLGVIAVYLRTRIEDTPVFLELEKKMASEPVR
PKTSIAEIFGKYKKAALSLGVLVAALNITYYILLAYMPTYMHKEVGASENMSLLAPLVGM
LAMMMFIPFAGRISDVVGFKKMWFFSLIGLFILAIPMFKLMSTGLTGSMIGFAVLGAFFV
PQLATISAMFPAMFPTQIRYAALAIVYNISASIFGGTTPLVCDQIIKFLGSPDAPAYYIM
VASALGIIALFFVIETKGCSIRGDGIPGAK