Protein Info for PP_4426 in Pseudomonas putida KT2440

Annotation: Amino acid ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 154 to 154 (1 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details TIGR03003: ectoine/hydroxyectoine ABC transporter, permease protein EhuD" amino acids 4 to 215 (212 residues), 384.8 bits, see alignment E=1.3e-119 TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 13 to 110 (98 residues), 92.3 bits, see alignment E=2.3e-30 PF00528: BPD_transp_1" amino acids 34 to 216 (183 residues), 82.4 bits, see alignment E=1.7e-27

Best Hits

Swiss-Prot: 46% identical to Y4TG_SINFN: Probable amino-acid ABC transporter permease protein y4tG (NGR_a01520) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to ppu:PP_4426)

MetaCyc: 33% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EM8 at UniProt or InterPro

Protein Sequence (218 amino acids)

>PP_4426 Amino acid ABC transporter, permease protein (Pseudomonas putida KT2440)
MNFFDWNYAIQLLPELFRAALNTIGVTLLGFAIAIVLGLFLAIGRRSARIWISWPIGGVI
EFIRSTPLLIQVYFLYYVLPNYGVSLTAMQVGVLGIGLHYACYLAEVYRSGLDAVPRGQW
EAVTALNMSPSLAYRNIILPQALRPILPPVGNYLVAMLKDTPVLSAITVVEIMQQAKNIG
SETFRYLEPITMVGVFFLALSIVLAYLVRRVEARLEQK