Protein Info for PP_4424 in Pseudomonas putida KT2440

Annotation: Uncharacterized HTH-type transcriptional regulator y4tD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF13404: HTH_AsnC-type" amino acids 3 to 44 (42 residues), 55.9 bits, see alignment E=6e-19 PF13412: HTH_24" amino acids 3 to 50 (48 residues), 58 bits, see alignment E=1.1e-19 PF13545: HTH_Crp_2" amino acids 16 to 60 (45 residues), 27.4 bits, see alignment E=5.4e-10 PF01037: AsnC_trans_reg" amino acids 69 to 142 (74 residues), 63.8 bits, see alignment E=2.2e-21

Best Hits

Swiss-Prot: 74% identical to Y4TD_SINFN: Uncharacterized HTH-type transcriptional regulator y4tD (NGR_a01550) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 100% identity to ppu:PP_4424)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EN0 at UniProt or InterPro

Protein Sequence (155 amino acids)

>PP_4424 Uncharacterized HTH-type transcriptional regulator y4tD (Pseudomonas putida KT2440)
MELDRIDLRILSALQVNNRLTSEELGDLVGLSSTACQRRLKRLRSEGVIESDISIINPKA
VGRHVTMLVLVTLERERSDIIDKFKQAIKNTPEVMSGSYVTGDADFVLLVTSKDMEDYEN
FTRRFFYENNDIKSFKTMVVMDRVKAGFTLPIDDA